Lineage for d1ez9b_ (1ez9 B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321832Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 321833Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 321834Family c.94.1.1: Phosphate binding protein-like [53851] (21 proteins)
  6. 321847Protein D-maltodextrin-binding protein, MBP [53862] (3 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 321852Species Escherichia coli [TaxId:562] [53863] (30 PDB entries)
  8. 321862Domain d1ez9b_: 1ez9 B: [64926]
    complexed with glc, glo

Details for d1ez9b_

PDB Entry: 1ez9 (more details), 1.9 Å

PDB Description: structure of maltotetraitol bound to open-form maltodextrin binding protein in p1 crystal form

SCOP Domain Sequences for d1ez9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez9b_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOP Domain Coordinates for d1ez9b_:

Click to download the PDB-style file with coordinates for d1ez9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ez9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ez9a_