Lineage for d1ez4c2 (1ez4 C:163-334)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420663Protein Lactate dehydrogenase [56339] (13 species)
  7. 420702Species Lactobacillus pentosus [TaxId:1589] [69843] (1 PDB entry)
  8. 420705Domain d1ez4c2: 1ez4 C:163-334 [64922]
    Other proteins in same PDB: d1ez4a1, d1ez4b1, d1ez4c1, d1ez4d1

Details for d1ez4c2

PDB Entry: 1ez4 (more details), 2.3 Å

PDB Description: crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution

SCOP Domain Sequences for d1ez4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez4c2 d.162.1.1 (C:163-334) Lactate dehydrogenase {Lactobacillus pentosus}
tsldssrlrvalgkqfnvdprsvdayimgehgdsefaaystatigtrpvrdvakeqgvsd
ddlakledgvrnkaydiinlkgatfygigtalmriskailrdenavlpvgaymdgqygln
diyigtpaiiggtglkqiiesplsadelkkmqdsaatlkkvlndglaelen

SCOP Domain Coordinates for d1ez4c2:

Click to download the PDB-style file with coordinates for d1ez4c2.
(The format of our PDB-style files is described here.)

Timeline for d1ez4c2: