Lineage for d1ez4b1 (1ez4 B:16-162)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175791Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 175798Protein Lactate dehydrogenase [51859] (11 species)
  7. 175833Species Lactobacillus pentosus [TaxId:1589] [69418] (1 PDB entry)
  8. 175835Domain d1ez4b1: 1ez4 B:16-162 [64919]
    Other proteins in same PDB: d1ez4a2, d1ez4b2, d1ez4c2, d1ez4d2

Details for d1ez4b1

PDB Entry: 1ez4 (more details), 2.3 Å

PDB Description: crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution

SCOP Domain Sequences for d1ez4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez4b1 c.2.1.5 (B:16-162) Lactate dehydrogenase {Lactobacillus pentosus}
smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
anpvdiltyatwkfsgfpkervigsg

SCOP Domain Coordinates for d1ez4b1:

Click to download the PDB-style file with coordinates for d1ez4b1.
(The format of our PDB-style files is described here.)

Timeline for d1ez4b1: