Lineage for d1ez4a1 (1ez4 A:16-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2453007Species Lactobacillus pentosus [TaxId:1589] [69418] (1 PDB entry)
  8. 2453008Domain d1ez4a1: 1ez4 A:16-162 [64917]
    Other proteins in same PDB: d1ez4a2, d1ez4b2, d1ez4c2, d1ez4d2
    complexed with nad

Details for d1ez4a1

PDB Entry: 1ez4 (more details), 2.3 Å

PDB Description: crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d1ez4a1:

Sequence, based on SEQRES records: (download)

>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}
smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
anpvdiltyatwkfsgfpkervigsg

Sequence, based on observed residues (ATOM records): (download)

>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}
smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
kiysgeysdckdadlvvitagalvnknlnilssivkpvvdsgfdgiflvaanpvdiltya
twkfsgfpkervigsg

SCOPe Domain Coordinates for d1ez4a1:

Click to download the PDB-style file with coordinates for d1ez4a1.
(The format of our PDB-style files is described here.)

Timeline for d1ez4a1: