Lineage for d1ey3f_ (1ey3 F:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690844Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 690845Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 690857Domain d1ey3f_: 1ey3 F: [64916]
    complexed with dak

Details for d1ey3f_

PDB Entry: 1ey3 (more details), 2.3 Å

PDB Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa
PDB Compounds: (F:) enoyl-coa hydratase

SCOP Domain Sequences for d1ey3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey3f_ c.14.1.3 (F:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]}
fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh

SCOP Domain Coordinates for d1ey3f_:

Click to download the PDB-style file with coordinates for d1ey3f_.
(The format of our PDB-style files is described here.)

Timeline for d1ey3f_: