![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (13 proteins) |
![]() | Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries) |
![]() | Domain d1ey3f_: 1ey3 F: [64916] complexed with dak |
PDB Entry: 1ey3 (more details), 2.3 Å
SCOP Domain Sequences for d1ey3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ey3f_ c.14.1.3 (F:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr regmsafvekrkanfkdh
Timeline for d1ey3f_: