Lineage for d1ey3d_ (1ey3 D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824543Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 824627Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 824628Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 824638Domain d1ey3d_: 1ey3 D: [64914]

Details for d1ey3d_

PDB Entry: 1ey3 (more details), 2.3 Å

PDB Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa
PDB Compounds: (D:) enoyl-coa hydratase

SCOP Domain Sequences for d1ey3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey3d_ c.14.1.3 (D:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]}
fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh

SCOP Domain Coordinates for d1ey3d_:

Click to download the PDB-style file with coordinates for d1ey3d_.
(The format of our PDB-style files is described here.)

Timeline for d1ey3d_: