Lineage for d1ey3b_ (1ey3 B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119892Fold c.14: ClpP/crotonase [52095] (1 superfamily)
  4. 119893Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 119929Family c.14.1.3: Crotonase-like [52103] (5 proteins)
  6. 119954Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species)
  7. 119955Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (3 PDB entries)
  8. 119957Domain d1ey3b_: 1ey3 B: [64912]

Details for d1ey3b_

PDB Entry: 1ey3 (more details), 2.3 Å

PDB Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa

SCOP Domain Sequences for d1ey3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey3b_ c.14.1.3 (B:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh

SCOP Domain Coordinates for d1ey3b_:

Click to download the PDB-style file with coordinates for d1ey3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ey3b_: