Lineage for d1ey3a_ (1ey3 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily) Superfamily c.14.1: ClpP/crotonase [52096] (3 families) 
Family c.14.1.3: Crotonase-like [52103] (5 proteins) 
Protein Enoyl-CoA hydratase (crotonase) [52106] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52107] (3 PDB entries) 
Domain d1ey3a_: 1ey3 A: [64911]
Details for d1ey3a_
PDB Entry: 1ey3 (more details), 2.3 Å
PDB Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa
SCOP Domain Sequences for d1ey3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ey3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus)}
fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh
SCOP Domain Coordinates for d1ey3a_:
Click to download the PDB-style file with coordinates for d1ey3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ey3a_:
- d1ey3a_ is new in SCOP 1.59
- d1ey3a_ appears in SCOP 1.61
- d1ey3a_ appears in the current release, SCOPe 2.08
View in 3D
