Lineage for d1ep8b_ (1ep8 B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (4 PDB entries) 
Domain d1ep8b_: 1ep8 B: [64908]
Details for d1ep8b_
PDB Entry: 1ep8 (more details), 2.2 Å
PDB Description: crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii
SCOP Domain Sequences for d1ep8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ep8b_ c.47.1.1 (B:) Thioredoxin {Chlamydomonas reinhardtii}
ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
SCOP Domain Coordinates for d1ep8b_:
Click to download the PDB-style file with coordinates for d1ep8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ep8b_:
- d1ep8b_ is new in SCOP 1.59
- d1ep8b_ appears in SCOP 1.61
- d1ep8b_ appears in the current release, SCOPe 2.08
View in 3D
