Lineage for d1ep7a_ (1ep7 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486472Family c.47.1.1: Thioltransferase [52834] (11 proteins)
  6. 486522Protein Thioredoxin [52835] (10 species)
  7. 486540Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (4 PDB entries)
  8. 486541Domain d1ep7a_: 1ep7 A: [64905]

Details for d1ep7a_

PDB Entry: 1ep7 (more details), 2.1 Å

PDB Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii

SCOP Domain Sequences for d1ep7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii}
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

SCOP Domain Coordinates for d1ep7a_:

Click to download the PDB-style file with coordinates for d1ep7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ep7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ep7b_