Lineage for d1ebba_ (1ebb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498790Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2498791Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2498792Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2498797Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species)
  7. 2498798Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries)
  8. 2498801Domain d1ebba_: 1ebb A: [64900]
    complexed with gol, so4

Details for d1ebba_

PDB Entry: 1ebb (more details), 2.3 Å

PDB Description: bacillus stearothermophilus yhfr
PDB Compounds: (A:) phosphatase

SCOPe Domain Sequences for d1ebba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebba_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]}
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshie

SCOPe Domain Coordinates for d1ebba_:

Click to download the PDB-style file with coordinates for d1ebba_.
(The format of our PDB-style files is described here.)

Timeline for d1ebba_: