SCOP 1.63: Domain d1ebba_: 1ebb A:

Lineage for d1ebba_ (1ebb A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)

6. Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries)

8. Domain d1ebba_: 1ebb A: [64900]
   complexed with gol, so4

Details for d1ebba_

PDB Entry: 1ebb, 2.3 Å

PDB Description: bacillus stearothermophilus yhfr

SCOP Domain Sequences for d1ebba_:

Sequence; same for both SEQRES and ATOM records:

>d1ebba_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus}
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshie

Timeline for d1ebba_:

• d1ebba_ first appeared in SCOP 1.59
  
• d1ebba_ appears in SCOP 1.61
  
• d1ebba_ appears in SCOP 1.65
  
• d1ebba_ appears in the current release, SCOPe 2.08