![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins) |
![]() | Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries) |
![]() | Domain d1ebba_: 1ebb A: [64900] |
PDB Entry: 1ebb (more details), 2.3 Å
SCOP Domain Sequences for d1ebba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebba_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus} attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv tiievdggtfhvavegdvshie
Timeline for d1ebba_: