Lineage for d1ebba_ (1ebb A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125227Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 125228Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 125229Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)
  6. 125230Protein Broad specificity phosphatase YhfR [69539] (1 species)
  7. 125231Species Bacillus stearothermophilus [TaxId:1422] [69540] (1 PDB entry)
  8. 125232Domain d1ebba_: 1ebb A: [64900]

Details for d1ebba_

PDB Entry: 1ebb (more details), 2.3 Å

PDB Description: bacillus stearothermophilus yhfr

SCOP Domain Sequences for d1ebba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebba_ c.60.1.1 (A:) Broad specificity phosphatase YhfR {Bacillus stearothermophilus}
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshie

SCOP Domain Coordinates for d1ebba_:

Click to download the PDB-style file with coordinates for d1ebba_.
(The format of our PDB-style files is described here.)

Timeline for d1ebba_: