Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins) automatically mapped to Pfam PF12697 |
Protein Hydroxynitrile lyase [53586] (2 species) |
Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (10 PDB entries) |
Domain d1eb9b1: 1eb9 B:2-258 [64899] Other proteins in same PDB: d1eb9a2, d1eb9b2 complexed with hba |
PDB Entry: 1eb9 (more details), 2.1 Å
SCOPe Domain Sequences for d1eb9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb9b1 c.69.1.20 (B:2-258) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]} vtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysepl ltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvekl lesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslfq nvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklqlt kteevahilqevadaya
Timeline for d1eb9b1: