Lineage for d1eb8b_ (1eb8 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870341Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 1870342Protein Hydroxynitrile lyase [53586] (2 species)
  7. 1870343Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (9 PDB entries)
  8. 1870349Domain d1eb8b_: 1eb8 B: [64897]
    complexed with mpd

Details for d1eb8b_

PDB Entry: 1eb8 (more details), 2.1 Å

PDB Description: structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
PDB Compounds: (B:) (s)-acetone-cyanohydrin lyase

SCOPe Domain Sequences for d1eb8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb8b_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

SCOPe Domain Coordinates for d1eb8b_:

Click to download the PDB-style file with coordinates for d1eb8b_.
(The format of our PDB-style files is described here.)

Timeline for d1eb8b_: