Lineage for d1eb4a_ (1eb4 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156518Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 156519Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 156586Family a.127.1.2: Histidine ammonia-lyase (HAL) [48572] (1 protein)
  6. 156587Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 156588Species Pseudomonas putida [TaxId:303] [48574] (6 PDB entries)
  8. 156595Domain d1eb4a_: 1eb4 A: [64894]

Details for d1eb4a_

PDB Entry: 1eb4 (more details), 2 Å

PDB Description: histidine ammonia-lyase (hal) mutant f329a from pseudomonas putida

SCOP Domain Sequences for d1eb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb4a_ a.127.1.2 (A:) Histidine ammonia-lyase (HAL) {Pseudomonas putida}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnahaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOP Domain Coordinates for d1eb4a_:

Click to download the PDB-style file with coordinates for d1eb4a_.
(The format of our PDB-style files is described here.)

Timeline for d1eb4a_: