Lineage for d1eb0a2 (1eb0 A:75-143)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) 
automatically mapped to Pfam PF05194Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins) Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species) 
Species Bacillus pasteurii [TaxId:1474] [69741] (2 PDB entries) 
Domain d1eb0a2: 1eb0 A:75-143 [64891]
Other proteins in same PDB: d1eb0a1
complexed with zn
Details for d1eb0a2
PDB Entry: 1eb0 (more details), 1.85 Å
PDB Description: crystal structure of bacillus pasteurii uree at 1.85 a, phased by siras. type i crystal form.
PDB Compounds: (A:) urease accessory protein ureeSCOPe Domain Sequences for d1eb0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb0a2 d.58.38.1 (A:75-143) Urease metallochaperone UreE, C-terminal domain {Bacillus pasteurii [TaxId: 1474]}
lekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktleklidevgvsyeqser
rfkepfkyr
SCOPe Domain Coordinates for d1eb0a2:
Click to download the PDB-style file with coordinates for d1eb0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eb0a2:
- d1eb0a2 first appeared in SCOP 1.59
- d1eb0a2 appears in SCOPe 2.07
View in 3D
