Lineage for d1eawd_ (1eaw D:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143647Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 143648Species Cow (Bos taurus) [TaxId:9913] [57365] (54 PDB entries)
  8. 143725Domain d1eawd_: 1eaw D: [64888]
    Other proteins in same PDB: d1eawa_, d1eawc_

Details for d1eawd_

PDB Entry: 1eaw (more details), 2.93 Å

PDB Description: crystal structure of the mtsp1 (matriptase)-bpti (aprotinin) complex

SCOP Domain Sequences for d1eawd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eawd_ g.8.1.1 (D:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d1eawd_:

Click to download the PDB-style file with coordinates for d1eawd_.
(The format of our PDB-style files is described here.)

Timeline for d1eawd_: