Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Matriptase MTSP1 [69284] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69285] (21 PDB entries) |
Domain d1eawc_: 1eaw C: [64887] Other proteins in same PDB: d1eawb_, d1eawd_ |
PDB Entry: 1eaw (more details), 2.93 Å
SCOPe Domain Sequences for d1eawc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eawc_ b.47.1.2 (C:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpiclpd ashvfpagkaiwvtgwghtqyggtgalilqkgeirvinqttcenllpqqitprmmcvgfl sggvdscqgdsggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg v
Timeline for d1eawc_: