SCOP 1.59: Domain d1eavb_: 1eav B:

Lineage for d1eavb_ (1eav B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.1: MogA-like [53219] (3 proteins)

6. Protein Plant CNX1 G domain [69537] (1 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [69538] (1 PDB entry)

8. Domain d1eavb_: 1eav B: [64878]

Details for d1eavb_

PDB Entry: 1eav, 2.6 Å

PDB Description: crystal structures of human gephyrin and plant cnx1 g domains - comparative analysis and functional implications

SCOP Domain Sequences for d1eavb_:

Sequence; same for both SEQRES and ATOM records:

>d1eavb_ c.57.1.1 (B:) Plant CNX1 G domain {Mouse-ear cress (Arabidopsis thaliana)}
gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
rsaagirgstliinmpgnpnavaecmeallpalkhalkqi

Timeline for d1eavb_:

• d1eavb_ is new in SCOP 1.59
  
• d1eavb_ appears in SCOP 1.61
  
• d1eavb_ appears in the current release, SCOPe 2.08