Lineage for d1eara1 (1ear A:1-74)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074968Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
    barrel, closed; n=6, S=8; a crossover loop topology
  4. 2074969Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) (S)
    automatically mapped to Pfam PF02814
  5. 2074970Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 protein domains)
  6. 2074971Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)
  7. 2074972Species Bacillus pasteurii [TaxId:1474] [69291] (2 PDB entries)
  8. 2074973Domain d1eara1: 1ear A:1-74 [64875]
    Other proteins in same PDB: d1eara2
    complexed with zn

Details for d1eara1

PDB Entry: 1ear (more details), 1.7 Å

PDB Description: crystal structure of bacillus pasteurii uree at 1.7 a. type ii crystal form.
PDB Compounds: (A:) urease accessory protein uree

SCOPe Domain Sequences for d1eara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eara1 b.107.1.1 (A:1-74) Urease metallochaperone UreE, N-terminal domain {Bacillus pasteurii [TaxId: 1474]}
mvitkivghiddlshqikkvdwlevewedlnkrilrketengtdiaiklensgtlrygdv
lyesddtliairtk

SCOPe Domain Coordinates for d1eara1:

Click to download the PDB-style file with coordinates for d1eara1.
(The format of our PDB-style files is described here.)

Timeline for d1eara1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eara2