Lineage for d1ea6b1 (1ea6 B:232-364)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325230Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 325231Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families) (S)
  5. 325290Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (4 proteins)
  6. 325307Protein DNA mismatch repair protein PMS2 [69656] (1 species)
  7. 325308Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries)
  8. 325312Domain d1ea6b1: 1ea6 B:232-364 [64873]
    Other proteins in same PDB: d1ea6a2, d1ea6b2
    complexed with adp, mg

Details for d1ea6b1

PDB Entry: 1ea6 (more details), 2.7 Å

PDB Description: n-terminal 40kda fragment of nhpms2 complexed with adp

SCOP Domain Sequences for d1ea6b1:

Sequence, based on SEQRES records: (download)

>d1ea6b1 d.14.1.3 (B:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfd

Sequence, based on observed residues (ATOM records): (download)

>d1ea6b1 d.14.1.3 (B:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdllqeeklllavlktslig
mfd

SCOP Domain Coordinates for d1ea6b1:

Click to download the PDB-style file with coordinates for d1ea6b1.
(The format of our PDB-style files is described here.)

Timeline for d1ea6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ea6b2