Lineage for d1ea6a2 (1ea6 A:27-231)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261744Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 261745Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 261761Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (4 proteins)
  6. 261777Protein DNA mismatch repair protein PMS2 [69800] (1 species)
  7. 261778Species Human (Homo sapiens) [TaxId:9606] [69801] (3 PDB entries)
  8. 261781Domain d1ea6a2: 1ea6 A:27-231 [64872]
    Other proteins in same PDB: d1ea6a1, d1ea6b1

Details for d1ea6a2

PDB Entry: 1ea6 (more details), 2.7 Å

PDB Description: n-terminal 40kda fragment of nhpms2 complexed with adp

SCOP Domain Sequences for d1ea6a2:

Sequence, based on SEQRES records: (download)

>d1ea6a2 d.122.1.2 (A:27-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
csgqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlk
hhtskiqefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqk
tpyprprgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnql
gqgkrqpvvctggspsikenigsvf

Sequence, based on observed residues (ATOM records): (download)

>d1ea6a2 d.122.1.2 (A:27-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
csgqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltle
alsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvr
hkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigs
vf

SCOP Domain Coordinates for d1ea6a2:

Click to download the PDB-style file with coordinates for d1ea6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ea6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ea6a1