SCOP 1.63: Domain d1ea6a1: 1ea6 A:232-364

Lineage for d1ea6a1 (1ea6 A:232-364)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (4 proteins)

6. Protein DNA mismatch repair protein PMS2 [69656] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries)

8. Domain d1ea6a1: 1ea6 A:232-364 [64871]
   Other proteins in same PDB: d1ea6a2, d1ea6b2

Details for d1ea6a1

PDB Entry: 1ea6, 2.7 Å

PDB Description: n-terminal 40kda fragment of nhpms2 complexed with adp

SCOP Domain Sequences for d1ea6a1:

Sequence, based on SEQRES records:

>d1ea6a1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfd

Sequence, based on observed residues (ATOM records):

>d1ea6a1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvllqeeklllavlktsligm
fd

Timeline for d1ea6a1:

• d1ea6a1 first appeared in SCOP 1.59
  
• d1ea6a1 appears in SCOP 1.61
  
• d1ea6a1 appears in SCOP 1.65
  
• d1ea6a1 appears in the current release, SCOPe 2.08