![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.3: CopG-like [100970] (4 proteins) similar to the phage repressor family |
![]() | Protein Transcriptional repressor CopG [47605] (1 species) plasmid-encoded |
![]() | Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries) |
![]() | Domain d1ea4k_: 1ea4 K: [64869] protein/DNA complex |
PDB Entry: 1ea4 (more details), 2.95 Å
SCOPe Domain Sequences for d1ea4k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ea4k_ a.43.1.3 (K:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]} mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
Timeline for d1ea4k_: