Lineage for d1ea4k_ (1ea4 K:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97823Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 97824Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 97864Family a.43.1.2: Bacterial repressors [47604] (3 proteins)
  6. 97901Protein Transcriptional repressor CopG [47605] (1 species)
  7. 97902Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)
  8. 97916Domain d1ea4k_: 1ea4 K: [64869]

Details for d1ea4k_

PDB Entry: 1ea4 (more details), 2.95 Å

PDB Description: transcriptional repressor copg/22bp dsdna complex

SCOP Domain Sequences for d1ea4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea4k_ a.43.1.2 (K:) Transcriptional repressor CopG {Streptococcus agalactiae}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgq

SCOP Domain Coordinates for d1ea4k_:

Click to download the PDB-style file with coordinates for d1ea4k_.
(The format of our PDB-style files is described here.)

Timeline for d1ea4k_: