Lineage for d1ea4f_ (1ea4 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325792Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 2325825Protein Transcriptional repressor CopG [47605] (1 species)
    plasmid-encoded
  7. 2325826Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)
  8. 2325836Domain d1ea4f_: 1ea4 F: [64865]
    protein/DNA complex

Details for d1ea4f_

PDB Entry: 1ea4 (more details), 2.95 Å

PDB Description: transcriptional repressor copg/22bp dsdna complex
PDB Compounds: (F:) transcriptional repressor copg

SCOPe Domain Sequences for d1ea4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea4f_ a.43.1.3 (F:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgqek

SCOPe Domain Coordinates for d1ea4f_:

Click to download the PDB-style file with coordinates for d1ea4f_.
(The format of our PDB-style files is described here.)

Timeline for d1ea4f_: