SCOPe 2.05: Domain d1ea4f_: 1ea4 F:

Lineage for d1ea4f_ (1ea4 F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.3: CopG-like [100970] (4 proteins)
   similar to the phage repressor family

6. Protein Transcriptional repressor CopG [47605] (1 species)
   plasmid-encoded

7. Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)

8. Domain d1ea4f_: 1ea4 F: [64865]
   protein/DNA complex

Details for d1ea4f_

PDB Entry: 1ea4, 2.95 Å

PDB Description: transcriptional repressor copg/22bp dsdna complex

PDB Compounds: (F:) transcriptional repressor copg

SCOPe Domain Sequences for d1ea4f_:

Sequence; same for both SEQRES and ATOM records:

>d1ea4f_ a.43.1.3 (F:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgqek

Timeline for d1ea4f_:

• d1ea4f_ first appeared in SCOP 1.59
  
• d1ea4f_ appears in SCOPe 2.04
  
• d1ea4f_ appears in SCOPe 2.06
  
• d1ea4f_ appears in the current release, SCOPe 2.08