Lineage for d1ea0b3 (1ea0 B:1-422)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548742Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 protein domains)
    has slightly different topology than other families do
  6. 2548743Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species)
  7. 2548744Species Azospirillum brasilense [TaxId:192] [69834] (2 PDB entries)
  8. 2548746Domain d1ea0b3: 1ea0 B:1-422 [64859]
    Other proteins in same PDB: d1ea0a1, d1ea0a2, d1ea0b1, d1ea0b2
    complexed with akg, f3s, fmn, omt

Details for d1ea0b3

PDB Entry: 1ea0 (more details), 3 Å

PDB Description: alpha subunit of a. brasilense glutamate synthase
PDB Compounds: (B:) glutamate synthase [nadph] large chain

SCOPe Domain Sequences for d1ea0b3:

Sequence, based on SEQRES records: (download)

>d1ea0b3 d.153.1.1 (B:1-422) Alpha subunit of glutamate synthase, N-terminal domain {Azospirillum brasilense [TaxId: 192]}
cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
qn

Sequence, based on observed residues (ATOM records): (download)

>d1ea0b3 d.153.1.1 (B:1-422) Alpha subunit of glutamate synthase, N-terminal domain {Azospirillum brasilense [TaxId: 192]}
cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
qaltttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittdgli
iggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwvqn

SCOPe Domain Coordinates for d1ea0b3:

Click to download the PDB-style file with coordinates for d1ea0b3.
(The format of our PDB-style files is described here.)

Timeline for d1ea0b3: