Lineage for d1ea0b2 (1ea0 B:423-1193)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080028Protein Alpha subunit of glutamate synthase, central and FMN domains [69381] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 2080029Species Azospirillum brasilense [TaxId:192] [69382] (2 PDB entries)
  8. 2080031Domain d1ea0b2: 1ea0 B:423-1193 [64858]
    Other proteins in same PDB: d1ea0a1, d1ea0a3, d1ea0b1, d1ea0b3
    complexed with akg, f3s, fmn, omt

Details for d1ea0b2

PDB Entry: 1ea0 (more details), 3 Å

PDB Description: alpha subunit of a. brasilense glutamate synthase
PDB Compounds: (B:) glutamate synthase [nadph] large chain

SCOPe Domain Sequences for d1ea0b2:

Sequence, based on SEQRES records: (download)

>d1ea0b2 c.1.4.1 (B:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]}
tthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmgdd
spiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqtrl
lqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrggat
hviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavligvg
attvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyrgg
gnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyrfr
ksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpvde
vesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkngdn
wnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhstpg
vmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadiil
isgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdivia
amlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlftfl
aeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpg

Sequence, based on observed residues (ATOM records): (download)

>d1ea0b2 c.1.4.1 (B:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]}
tthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmgdd
spiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqtrl
lqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrggat
hviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavligvg
attvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyrgg
gnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyrfr
ksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpvde
vesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkngdn
wnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhstpg
vmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadiil
isgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdivia
amlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlftfl
aeevreilaglgfrslnevigrtdllhqvdldlnprlaqvdpg

SCOPe Domain Coordinates for d1ea0b2:

Click to download the PDB-style file with coordinates for d1ea0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ea0b2: