Lineage for d1e9za2 (1e9z A:1-105)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635756Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 1635757Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 1635758Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
    automatically mapped to Pfam PF00547
  6. 1635759Protein Urease, gamma-subunit [54113] (4 species)
  7. 1635775Species Helicobacter pylori [TaxId:210] [69631] (2 PDB entries)
    fused with beta subunit
  8. 1635777Domain d1e9za2: 1e9z A:1-105 [64851]
    Other proteins in same PDB: d1e9za1, d1e9zb1, d1e9zb2
    complexed with ni

Details for d1e9za2

PDB Entry: 1e9z (more details), 3 Å

PDB Description: crystal structure of helicobacter pylori urease
PDB Compounds: (A:) urease subunit alpha

SCOPe Domain Sequences for d1e9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9za2 d.8.1.1 (A:1-105) Urease, gamma-subunit {Helicobacter pylori [TaxId: 210]}
mkltpkeldklmlhyagelakkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

SCOPe Domain Coordinates for d1e9za2:

Click to download the PDB-style file with coordinates for d1e9za2.
(The format of our PDB-style files is described here.)

Timeline for d1e9za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9za1