![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
![]() | Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) automatically mapped to Pfam PF00547 |
![]() | Protein Urease, gamma-subunit [54113] (4 species) |
![]() | Species Helicobacter pylori [TaxId:210] [69631] (2 PDB entries) fused with beta subunit |
![]() | Domain d1e9za2: 1e9z A:1-105 [64851] Other proteins in same PDB: d1e9za1, d1e9zb1, d1e9zb2 complexed with ni |
PDB Entry: 1e9z (more details), 3 Å
SCOPe Domain Sequences for d1e9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e9za2 d.8.1.1 (A:1-105) Urease, gamma-subunit {Helicobacter pylori [TaxId: 210]} mkltpkeldklmlhyagelakkrkekgiklnyveavalisahimeearagkktaaelmqe grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk
Timeline for d1e9za2: