Lineage for d1e9za2 (1e9z A:1-105)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188733Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 188734Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 188735Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 188736Protein Urease, gamma-subunit [54113] (3 species)
  7. 188743Species Helicobacter pylori [TaxId:210] [69631] (2 PDB entries)
  8. 188745Domain d1e9za2: 1e9z A:1-105 [64851]
    Other proteins in same PDB: d1e9za1, d1e9zb1, d1e9zb2

Details for d1e9za2

PDB Entry: 1e9z (more details), 3 Å

PDB Description: crystal structure of helicobacter pylori urease

SCOP Domain Sequences for d1e9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9za2 d.8.1.1 (A:1-105) Urease, gamma-subunit {Helicobacter pylori}
mkltpkeldklmlhyagelakkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

SCOP Domain Coordinates for d1e9za2:

Click to download the PDB-style file with coordinates for d1e9za2.
(The format of our PDB-style files is described here.)

Timeline for d1e9za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9za1