Lineage for d1e9yb1 (1e9y B:1-131,B:432-480)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678879Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 678880Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (8 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 678881Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 678882Protein alpha-Subunit of urease [51340] (3 species)
  7. 678890Species Helicobacter pylori [TaxId:210] [69376] (2 PDB entries)
  8. 678891Domain d1e9yb1: 1e9y B:1-131,B:432-480 [64848]
    Other proteins in same PDB: d1e9ya1, d1e9ya2, d1e9yb2
    complexed with hae, ni

Details for d1e9yb1

PDB Entry: 1e9y (more details), 3 Å

PDB Description: crystal structure of helicobacter pylori urease in complex with acetohydroxamic acid
PDB Compounds: (B:) methionine

SCOP Domain Sequences for d1e9yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9yb1 b.92.1.1 (B:1-131,B:432-480) alpha-Subunit of urease {Helicobacter pylori [TaxId: 210]}
mkkisrkeyvsmygpttgdkvrlgdtdliaevehdytiygeelkfgggktlregmsqsnn
pskeeldliitnalivdytgiykadigikdgkiagigkggnkdmqdgvknnlsvgpatea
lageglivtagXadlvlwspaffgvkpnmiikggfialsqmgdanasiptpqpvyyremf
a

SCOP Domain Coordinates for d1e9yb1:

Click to download the PDB-style file with coordinates for d1e9yb1.
(The format of our PDB-style files is described here.)

Timeline for d1e9yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9yb2