SCOPe 2.04: Domain d1e9ya2: 1e9y A:1-105

Lineage for d1e9ya2 (1e9y A:1-105)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Helicobacter pylori [TaxId:210] [69631] (2 PDB entries)
   fused with beta subunit

8. Domain d1e9ya2: 1e9y A:1-105 [64847]
   Other proteins in same PDB: d1e9ya1, d1e9yb1, d1e9yb2
   complexed with hae, ni

Details for d1e9ya2

PDB Entry: 1e9y, 3 Å

PDB Description: crystal structure of helicobacter pylori urease in complex with acetohydroxamic acid

PDB Compounds: (A:) urease subunit alpha

SCOPe Domain Sequences for d1e9ya2:

Sequence; same for both SEQRES and ATOM records:

>d1e9ya2 d.8.1.1 (A:1-105) Urease, gamma-subunit {Helicobacter pylori [TaxId: 210]}
mkltpkeldklmlhyagelakkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

Timeline for d1e9ya2:

• d1e9ya2 first appeared in SCOP 1.59
  
• d1e9ya2 appears in SCOPe 2.03
  
• d1e9ya2 appears in SCOPe 2.05
  
• d1e9ya2 appears in the current release, SCOPe 2.08