Lineage for d1e9ya2 (1e9y A:1-105)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407171Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 407172Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 407173Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 407174Protein Urease, gamma-subunit [54113] (3 species)
  7. 407182Species Helicobacter pylori [TaxId:210] [69631] (2 PDB entries)
    fused with beta subunit
  8. 407183Domain d1e9ya2: 1e9y A:1-105 [64847]
    Other proteins in same PDB: d1e9ya1, d1e9yb1, d1e9yb2
    complexed with hae, ni

Details for d1e9ya2

PDB Entry: 1e9y (more details), 3 Å

PDB Description: crystal structure of helicobacter pylori urease in complex with acetohydroxamic acid

SCOP Domain Sequences for d1e9ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ya2 d.8.1.1 (A:1-105) Urease, gamma-subunit {Helicobacter pylori}
mkltpkeldklmlhyagelakkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

SCOP Domain Coordinates for d1e9ya2:

Click to download the PDB-style file with coordinates for d1e9ya2.
(The format of our PDB-style files is described here.)

Timeline for d1e9ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e9ya1