Lineage for d1e9rg_ (1e9r G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112146Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. 2112147Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. 2112153Domain d1e9rg_: 1e9r G: [64832]
    complexed with so4

Details for d1e9rg_

PDB Entry: 1e9r (more details), 2.4 Å

PDB Description: bacterial conjugative coupling protein trwbdeltan70. trigonal form in complex with sulphate.
PDB Compounds: (G:) conjugal transfer protein trwb

SCOPe Domain Sequences for d1e9rg_:

Sequence, based on SEQRES records: (download)

>d1e9rg_ c.37.1.11 (G:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}
qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
erdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqf
anrqpafveg

Sequence, based on observed residues (ATOM records): (download)

>d1e9rg_ c.37.1.11 (G:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}
qgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtg
ksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndy
dwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlr
gflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfi
twredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgr
kaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehev
erdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg

SCOPe Domain Coordinates for d1e9rg_:

Click to download the PDB-style file with coordinates for d1e9rg_.
(The format of our PDB-style files is described here.)

Timeline for d1e9rg_: