Lineage for d1e9rf_ (1e9r F:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. Domain d1e9rf_: 1e9r F: [64831]
    complexed with so4

Details for d1e9rf_

PDB Entry: 1e9r (more details), 2.4 Å

PDB Description: bacterial conjugative coupling protein trwbdeltan70. trigonal form in complex with sulphate.
PDB Compounds: (F:) conjugal transfer protein trwb

SCOPe Domain Sequences for d1e9rf_:

Sequence, based on SEQRES records: (download)

>d1e9rf_ c.37.1.11 (F:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}
gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
nrqpafveg

Sequence, based on observed residues (ATOM records): (download)

>d1e9rf_ c.37.1.11 (F:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}
gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
rdralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg

SCOPe Domain Coordinates for d1e9rf_ are not available.

Timeline for d1e9rf_:

Domains from other chains:
(mouse over for more information)
d1e9ra_, d1e9rb_, d1e9rd_, d1e9re_, d1e9rg_