Lineage for d1e9ka_ (1e9k A:)
- Root: SCOP 1.61
Class j: Peptides [58231] (95 folds) 
Fold j.87: Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70022] (1 superfamily) Superfamily j.87.1: Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70023] (1 family) 
Family j.87.1.1: Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70024] (1 protein) Protein Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70025] (1 species) Species Synthetic [70026] (1 PDB entry) 
Domain d1e9ka_: 1e9k A: [64826]
Details for d1e9ka_
PDB Entry: 1e9k (more details)
PDB Description: the structure of the rack1 interaction sites located within the unique n-terminal region of the camp-specific phosphodiesterase, pde4d5.
SCOP Domain Sequences for d1e9ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e9ka_ j.87.1.1 (A:) Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. {Synthetic}
vpevdnphcpnpwlnedlvkslrenllqheksktarks
SCOP Domain Coordinates for d1e9ka_:
Click to download the PDB-style file with coordinates for d1e9ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e9ka_:
- d1e9ka_ first appeared in SCOP 1.59
- d1e9ka_ appears in SCOP 1.63
- d1e9ka_ appears in the current release, SCOPe 2.08
View in 3D