Lineage for d1e9ka_ (1e9k A:)

  1. Root: SCOP 1.59
  2. 146832Class j: Peptides [58231] (92 folds)
  3. 147853Fold j.87: Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70022] (1 superfamily)
  4. 147854Superfamily j.87.1: Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70023] (1 family) (S)
  5. 147855Family j.87.1.1: Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70024] (1 protein)
  6. 147856Protein Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. [70025] (1 species)
  7. 147857Species Synthetic [70026] (1 PDB entry)
  8. 147858Domain d1e9ka_: 1e9k A: [64826]

Details for d1e9ka_

PDB Entry: 1e9k (more details)

PDB Description: the structure of the rack1 interaction sites located within the unique n-terminal region of the camp-specific phosphodiesterase, pde4d5.

SCOP Domain Sequences for d1e9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ka_ j.87.1.1 (A:) Rack1 interaction site of the CAMP-specific phosphodiesterase pde4d5. {Synthetic}
vpevdnphcpnpwlnedlvkslrenllqheksktarks

SCOP Domain Coordinates for d1e9ka_:

Click to download the PDB-style file with coordinates for d1e9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e9ka_: