Lineage for d1e9id1 (1e9i D:140-431)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 572968Family c.1.11.1: Enolase [51605] (1 protein)
  6. 572969Protein Enolase [51606] (6 species)
    Fold of this protein slightly differs from common fold in topology
  7. 572997Species Escherichia coli [TaxId:562] [69396] (1 PDB entry)
  8. 573001Domain d1e9id1: 1e9i D:140-431 [64824]
    Other proteins in same PDB: d1e9ia2, d1e9ib2, d1e9ic2, d1e9id2
    CASP4
    complexed with mg, so4

Details for d1e9id1

PDB Entry: 1e9i (more details), 2.48 Å

PDB Description: enolase from e.coli

SCOP Domain Sequences for d1e9id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9id1 c.1.11.1 (D:140-431) Enolase {Escherichia coli}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa

SCOP Domain Coordinates for d1e9id1:

Click to download the PDB-style file with coordinates for d1e9id1.
(The format of our PDB-style files is described here.)

Timeline for d1e9id1: