Lineage for d1e9ic2 (1e9i C:1-139)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein Enolase [54828] (10 species)
  7. Species Escherichia coli [TaxId:562] [69710] (2 PDB entries)
  8. Domain d1e9ic2: 1e9i C:1-139 [64823]
    Other proteins in same PDB: d1e9ia1, d1e9ib1, d1e9ic1, d1e9id1
    complexed with mg, so4

Details for d1e9ic2

PDB Entry: 1e9i (more details), 2.48 Å

PDB Description: enolase from e.coli
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d1e9ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ic2 d.54.1.1 (C:1-139) Enolase {Escherichia coli [TaxId: 562]}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

SCOPe Domain Coordinates for d1e9ic2 are not available.

Timeline for d1e9ic2:

Domains from same chain:
(mouse over for more information)
d1e9ic1
Domains from other chains:
(mouse over for more information)
d1e9ia1, d1e9ia2, d1e9ib1, d1e9ib2, d1e9id1, d1e9id2