Lineage for d1e9hd2 (1e9h D:310-432)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154336Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 154337Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 154338Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 154343Protein Cyclin A [47956] (2 species)
  7. 154347Species Human (Homo sapiens) [TaxId:9606] [47957] (7 PDB entries)
  8. 154365Domain d1e9hd2: 1e9h D:310-432 [64817]
    Other proteins in same PDB: d1e9ha_, d1e9hc_

Details for d1e9hd2

PDB Entry: 1e9h (more details), 2.5 Å

PDB Description: thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound

SCOP Domain Sequences for d1e9hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9hd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1e9hd2:

Click to download the PDB-style file with coordinates for d1e9hd2.
(The format of our PDB-style files is described here.)

Timeline for d1e9hd2: