Lineage for d1e9hd1 (1e9h D:175-309)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091941Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1091942Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 1091943Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 1091956Protein Cyclin A [47956] (2 species)
  7. 1091988Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries)
    Uniprot P20248 175-432
  8. 1092133Domain d1e9hd1: 1e9h D:175-309 [64816]
    Other proteins in same PDB: d1e9ha_, d1e9hc_
    complexed with inr

Details for d1e9hd1

PDB Entry: 1e9h (more details), 2.5 Å

PDB Description: thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound
PDB Compounds: (D:) cyclin a3

SCOPe Domain Sequences for d1e9hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9hd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1e9hd1:

Click to download the PDB-style file with coordinates for d1e9hd1.
(The format of our PDB-style files is described here.)

Timeline for d1e9hd1: