Lineage for d1e9fa_ (1e9f A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179299Protein Thymidylate kinase [52563] (4 species)
  7. 179316Species Human (Homo sapiens) [TaxId:9606] [64010] (13 PDB entries)
  8. 179329Domain d1e9fa_: 1e9f A: [64811]

Details for d1e9fa_

PDB Entry: 1e9f (more details), 1.9 Å

PDB Description: mutant human thymidylate kinase complexed with tmp and adp

SCOP Domain Sequences for d1e9fa_:

Sequence, based on SEQRES records: (download)

>d1e9fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgrargeleryengafqeralrcfhqlmkdttlnwkmvdas
ksieavhedirvlsedaiatatekplgelwk

Sequence, based on observed residues (ATOM records): (download)

>d1e9fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakryengafqeralrcfhqlmkdttlnwkmvdasksieavhed
irvlsedaiatatekplgelwk

SCOP Domain Coordinates for d1e9fa_:

Click to download the PDB-style file with coordinates for d1e9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1e9fa_: