Lineage for d1e9da_ (1e9d A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein Thymidylate kinase [52563] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries)
  8. Domain d1e9da_: 1e9d A: [64809]
    complexed with adp, atm, mg; mutant

Details for d1e9da_

PDB Entry: 1e9d (more details), 1.7000000000000002 Å

PDB Description: mutant human thymidylate kinase (f105y) complexed with aztmp and adp
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d1e9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9da_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}
arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaytgakenfsldwckqpdv
glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
sieavhedirvlsedaiatatekplkelwk

SCOPe Domain Coordinates for d1e9da_ are not available.

Timeline for d1e9da_: