SCOPe 2.05: Domain d1e9ca_: 1e9c A:

Lineage for d1e9ca_ (1e9c A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Thymidylate kinase [52563] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries)

8. Domain d1e9ca_: 1e9c A: [64808]
   complexed with adp, anp, mg, tmp; mutant

Details for d1e9ca_

PDB Entry: 1e9c, 1.6 Å

PDB Description: mutant human thymidylate kinase complexed with tmp and appnp

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d1e9ca_:

Sequence; same for both SEQRES and ATOM records:

>d1e9ca_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaytgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplkelwk

Timeline for d1e9ca_:

• d1e9ca_ first appeared in SCOP 1.59
  
• d1e9ca_ appears in SCOPe 2.04
  
• d1e9ca_ appears in SCOPe 2.06
  
• d1e9ca_ appears in the current release, SCOPe 2.08