Lineage for d1e9aa_ (1e9a A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829678Protein Thymidylate kinase [52563] (4 species)
  7. 829695Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries)
  8. 829700Domain d1e9aa_: 1e9a A: [64806]
    complexed with mg, z5a; mutant

Details for d1e9aa_

PDB Entry: 1e9a (more details), 1.6 Å

PDB Description: human thymidylate kinase complexed with the bisubstrate inhibitor aztp5a
PDB Compounds: (A:) thymidylate kinase

SCOP Domain Sequences for d1e9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9aa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplgelwk

SCOP Domain Coordinates for d1e9aa_:

Click to download the PDB-style file with coordinates for d1e9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1e9aa_: