Lineage for d1e98a_ (1e98 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313182Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 313352Protein Thymidylate kinase [52563] (4 species)
  7. 313369Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries)
  8. 313384Domain d1e98a_: 1e98 A: [64804]
    complexed with adp, atm, mg; mutant

Details for d1e98a_

PDB Entry: 1e98 (more details), 1.9 Å

PDB Description: wild type human thymidylate kinase complexed with aztmp and adp

SCOP Domain Sequences for d1e98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e98a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdv
glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
rieavheeirvlsedairtatekplgelwk

SCOP Domain Coordinates for d1e98a_:

Click to download the PDB-style file with coordinates for d1e98a_.
(The format of our PDB-style files is described here.)

Timeline for d1e98a_: