Lineage for d1e98a_ (1e98 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179299Protein Thymidylate kinase [52563] (4 species)
  7. 179316Species Human (Homo sapiens) [TaxId:9606] [64010] (13 PDB entries)
  8. 179327Domain d1e98a_: 1e98 A: [64804]

Details for d1e98a_

PDB Entry: 1e98 (more details), 1.9 Å

PDB Description: wild type human thymidylate kinase complexed with aztmp and adp

SCOP Domain Sequences for d1e98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e98a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens)}
arrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksd
vedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdv
glpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdask
rieavheeirvlsedairtatekplgelwk

SCOP Domain Coordinates for d1e98a_:

Click to download the PDB-style file with coordinates for d1e98a_.
(The format of our PDB-style files is described here.)

Timeline for d1e98a_: